General Information

  • ID:  hor005294
  • Uniprot ID:  P81028
  • Protein name:  Peptide YY-like
  • Gene name:  NA
  • Organism:  Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oreochromis (genus), Oreochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPPKPESPGSDASPEDWAKYHAAVRHYVNLITRQRY
  • Length:  36
  • Propeptide:  YPPKPESPGSDASPEDWAKYHAAVRHYVNLITRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81028-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P81028-F1.pdbhor005294_AF2.pdbhor005294_ESM.pdb

Physical Information

Mass: 482509 Formula: C190H280N54O55
Absent amino acids: CFM Common amino acids: P
pI: 8.97 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -117.78 Boman Index: -9332
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 48.89
Instability Index: 8123.61 Extinction Coefficient cystines: 11460
Absorbance 280nm: 327.43

Literature

  • PubMed ID:  7656183
  • Title:  Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.